DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and zgc:92590

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001007055.1 Gene:zgc:92590 / 474322 ZFINID:ZDB-GENE-041024-15 Length:247 Species:Danio rerio


Alignment Length:252 Identity:74/252 - (29%)
Similarity:119/252 - (47%) Gaps:28/252 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FLLFLVLPVQSAPGKLNGRVVGGEDAVKNQFPHQVSLR-NAGSHSCGGSILTRTYILTAAHC--V 74
            |.|.::....||..|    ::||.:...|..|.|:.|. :.|...||.|::...:.::||||  |
Zfish     6 FALLVLAVACSADDK----IIGGYECSPNSQPWQIYLTYDNGQRWCGASLINDRWAVSAAHCYLV 66

  Fly    75 SNEDVNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNFL--NDVALLRLESPLILS 137
            :|....|    :......:..|:..|      ::..:||.|.:|.::.  ||..|::|:.|.:.:
Zfish    67 ANRLTVH----LGEHNVAVEEGTEQR------IKAEKVIPHPKYNDYTLDNDFMLIKLKEPAVFN 121

  Fly   138 ASIQPIDLPTVDTPADVDVVISGWGRIKHQGDL-PRYLQYNTLKSITRQQCEELIDFGFEGELCL 201
            ..:||:.|.|..:......::||||.:.:.|.: |..||...|..:||.|||....:.....:..
Zfish   122 QYVQPVPLTTSCSSEGEQCLVSGWGNLINTGVVYPDVLQCLNLPVLTRAQCEGAYGWQITKNMFC 186

  Fly   202 LHQVDNG--ACNGDSGGPAVYNNQLVGVA--GFVVDGCG-STYPDGYARVFYFKDWI 253
            ...::.|  ||.||||||.:.|.:|.||.  |:   ||. |.||..|..|..:.||:
Zfish   187 AGFMEGGKDACQGDSGGPVICNGELRGVVSWGY---GCADSGYPGVYTEVCRYTDWV 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 68/232 (29%)
Tryp_SPc 32..256 CDD:238113 69/233 (30%)
zgc:92590NP_001007055.1 Tryp_SPc 20..240 CDD:214473 69/236 (29%)
Tryp_SPc 21..243 CDD:238113 69/233 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.