DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and KLK12

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_062544.1 Gene:KLK12 / 43849 HGNCID:6360 Length:254 Species:Homo sapiens


Alignment Length:260 Identity:73/260 - (28%)
Similarity:109/260 - (41%) Gaps:49/260 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LCSFLLFLVLPVQSAPGKLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHCV 74
            |..|||..||.:..|   ...::..|.:..:|..|.||.|....|..|||.::...::|||||| 
Human     3 LSIFLLLCVLGLSQA---ATPKIFNGTECGRNSQPWQVGLFEGTSLRCGGVLIDHRWVLTAAHC- 63

  Fly    75 SNEDVNHVITPIAAERFTIRAGSNDRFSGGVLVQV--AEVIVHEEYG----NFL-------NDVA 126
                        :..|:.:|.|.:.      |.|:  .|.|.|..:.    .:|       :|:.
Human    64 ------------SGSRYWVRLGEHS------LSQLDWTEQIRHSGFSVTHPGYLGASTSHEHDLR 110

  Fly   127 LLRLESPLILSASIQPIDLPTVDTPADVDVVISGWGRIKH-QGDLPRYLQYNTLKSITRQQCEEL 190
            ||||..|:.:::|:||:.||.....|..:..:||||...| :...|..||...|..::...|..:
Human   111 LLRLRLPVRVTSSVQPLPLPNDCATAGTECHVSGWGITNHPRNPFPDLLQCLNLSIVSHATCHGV 175

  Fly   191 IDFGFEGEL-----CLLHQVDNGACNGDSGGPAVYNNQLVGVAGF-VVDGCGSTYPDGYARVFYF 249
                :.|.:     |........||.||||||.|....|.|:..: .|..||.   ||...|:.:
Human   176 ----YPGRITSNMVCAGGVPGQDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQ---DGIPGVYTY 233

  Fly   250  249
            Human   234  233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 66/239 (28%)
Tryp_SPc 32..256 CDD:238113 66/238 (28%)
KLK12NP_062544.1 Tryp_SPc 21..236 CDD:214473 66/239 (28%)
Tryp_SPc 22..236 CDD:238113 66/238 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.