DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and CG9733

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:265 Identity:78/265 - (29%)
Similarity:125/265 - (47%) Gaps:43/265 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LNGRVVGGEDAVKNQFPHQVSL---RNAG---SHSCGGSILTRTYILTAAHCVSNEDVNHVITPI 86
            :..|:..|:|...|:||..|.|   |.:|   |.:|.||::.|.|:||||||::......|.|.:
  Fly   158 IRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCLTGRIEREVGTLV 222

  Fly    87 AAERFTIRAGSNDRFS-------GGVL---VQ---VAEVIVHEEY----GNFLNDVALLRLESPL 134
                 ::|.|.:|..:       ||..   ||   ..|:.|||.|    .|.::|:.|:|:|..:
  Fly   223 -----SVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQVHDIGLIRMERNV 282

  Fly   135 ILSASIQPIDLPT----VDTPADVDVVISGWGR-IKHQGDLPRYLQYNTLKSITRQQCEE---LI 191
            ..|.:||||.||:    ....:.....::|||| :|......:  |..|:..:...:|.:   .|
  Fly   283 RYSDNIQPICLPSSVGLESRQSGQQFTVAGWGRTLKMARSAVK--QKVTVNYVDPAKCRQRFSQI 345

  Fly   192 DFGFE-GELCLLHQVDNGACNGDSGGPAV-YNNQLVGVAGFVVDG--CG-STYPDGYARVFYFKD 251
            ....| .:||...|....:|:||||||.: :.::...:.|.|..|  || ..:|..|..|..:..
  Fly   346 KVNLEPTQLCAGGQFRKDSCDGDSGGPLMRFRDESWVLEGIVSFGYKCGLKDWPGVYTNVAAYDI 410

  Fly   252 WIKKH 256
            ||:::
  Fly   411 WIRQN 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 76/257 (30%)
Tryp_SPc 32..256 CDD:238113 77/259 (30%)
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 76/257 (30%)
Tryp_SPc 162..415 CDD:238113 77/259 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457352
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.