DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and CG9737

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:267 Identity:71/267 - (26%)
Similarity:117/267 - (43%) Gaps:45/267 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KLNGRVVGGEDAVKNQFPHQVSL-RNAGSHSCGGSILTRTYILTAAHCVSNEDV--NHVITPIAA 88
            ::..|:.|||.|..::||....| .|:..:.|.|:::...:||||||||..|.|  ...:..:..
  Fly   145 QVTNRIYGGEIAELDEFPWLALLVYNSNDYGCSGALIDDRHILTAAHCVQGEGVRDRQGLKHVRL 209

  Fly    89 ERFTIRA------GSNDRFSGGVLVQVA--EVIVHEEYGNF----LNDVALLRLESPLILSASIQ 141
            ..|.::.      ..|........:.:|  ::.||.||..|    .||:|::||:.|:..:..:.
  Fly   210 GEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFTHFVM 274

  Fly   142 PIDLPTVDTPADVD----VVISGWGRIKHQGDL----------PRYLQYNTLKSITRQQCEELID 192
            ||.||....|..:.    ..:|||||.    ||          |..|:.. :..::.:.|.::::
  Fly   275 PICLPNKSEPLTLAEGQMFSVSGWGRT----DLFNKYFINIHSPIKLKLR-IPYVSNENCTKILE 334

  Fly   193 -FGFE---GELCLLHQVDNGACNGDSGGPAVYNNQ------LVGVAGFVVDGCG-STYPDGYARV 246
             ||..   .::|...:.....|.||||||.:|.::      ..||..:....|| :..|..|..|
  Fly   335 GFGVRLGPKQICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCGMAGKPAVYTNV 399

  Fly   247 FYFKDWI 253
            ..:.|||
  Fly   400 AEYTDWI 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 69/261 (26%)
Tryp_SPc 32..256 CDD:238113 70/262 (27%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 69/261 (26%)
Tryp_SPc 150..409 CDD:238113 70/262 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457518
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.