DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and CG4053

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster


Alignment Length:263 Identity:87/263 - (33%)
Similarity:131/263 - (49%) Gaps:31/263 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FLLFLVLPVQSAPGK-------LNGRVVGGEDAVKNQFPHQVSLRNA-GSHSCGGSILTRTYILT 69
            :||.|...:....||       |:.|:|||::|.....|:|||::.. .:|.|.|.||...:|||
  Fly     9 WLLLLGTSIDVTRGKRLDNRKLLDNRIVGGQEAEDGVAPYQVSIQTIWKTHICSGVILNEQWILT 73

  Fly    70 AAHCV---SNEDVNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYG---NFLNDVALL 128
            |.||.   |.||:..::            |:|||...|..:...|.:||..|.   .:.||:||:
  Fly    74 AGHCALDFSIEDLRIIV------------GTNDRLEPGQTLFPDEALVHCLYDIPYVYNNDIALI 126

  Fly   129 RLESPLILSASIQPIDLPTVDTPADVDVVISGWGRIKHQGDLPRYLQYNTLKSITRQQCEELIDF 193
            .:...:|.:...|.::|.....||...|.::|||..:......:|||...|..|..::|.|..||
  Fly   127 HVNESIIFNDRTQIVELSREQPPAGSTVTLTGWGAPESSYPTVQYLQTLNLTIIAHEECRERWDF 191

  Fly   194 --GFE-GELCLLHQVDNGACNGDSGGPAVYNNQLVGVAGFVVDGCGSTYPDGYARVFYFKDWIKK 255
              |.: |.:|...:...|||:||||||.::..:|||:..: ...||...||.||...|::|||::
  Fly   192 HDGIDIGHICTFTREGEGACSGDSGGPLMWEGKLVGLVNW-GRACGVGMPDMYANTVYYQDWIRR 255

  Fly   256 -HS 257
             ||
  Fly   256 THS 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 77/231 (33%)
Tryp_SPc 32..256 CDD:238113 78/234 (33%)
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 77/231 (33%)
Tryp_SPc 35..256 CDD:238113 78/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.