DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and CG17475

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:243 Identity:76/243 - (31%)
Similarity:116/243 - (47%) Gaps:21/243 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VQSAPG-KLNGRVVGGEDAVKNQFPHQVSLRNA-GSHSCGGSILTRTYILTAAHCV--SNEDVNH 81
            :..|.| ....||:.|||....:..:|:||:.. |.|.|||.|:...::|||||||  .|.....
  Fly    38 ISKAEGVNFQNRVINGEDVQLGEAKYQISLQGMYGGHICGGCIIDERHVLTAAHCVYGYNPTYLR 102

  Fly    82 VITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYG--NFLNDVALLRLESPLILSASIQPID 144
            |||           |:.:......:..|.|..:|..|.  ::.||:||:||...:..:...||.:
  Fly   103 VIT-----------GTVEYEKPDAVYFVEEHWIHCNYNSPDYHNDIALIRLNDTIKFNEYTQPAE 156

  Fly   145 LPTVDTPADVDVVISGWGRIKHQGDLPRYLQYNTLKSITRQQCEELIDFGFEG---ELCLLHQVD 206
            |||........::::|||..:..||.|..||...|..:....|:|:::.....   .:|.|....
  Fly   157 LPTAPVANGTQLLLTGWGSTELWGDTPDILQKAYLTHVVYSTCQEIMNNDPSNGPCHICTLTTGG 221

  Fly   207 NGACNGDSGGPAVYNNQLVGVAGFVVDGCGSTYPDGYARVFYFKDWIK 254
            .|||:||||||..:|..|.|:..:... |....||.:|.|:|:.:||:
  Fly   222 QGACHGDSGGPLTHNGVLYGLVNWGYP-CALGVPDSHANVYYYLEWIR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 72/229 (31%)
Tryp_SPc 32..256 CDD:238113 73/231 (32%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 72/229 (31%)
Tryp_SPc 50..269 CDD:238113 73/231 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.