DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and CG17477

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:233 Identity:74/233 - (31%)
Similarity:116/233 - (49%) Gaps:19/233 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VVGGEDAVKNQFPHQVSLRN-AGSHSCGGSILTRTYILTAAHCVSNEDVNHVITPIAAERFTIRA 95
            :|||::|.:...|:||||:. .|||.|||:|::..:|:||.|||..         ....|..:..
  Fly    27 IVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKG---------YPTSRLQVAT 82

  Fly    96 GSNDRFSGGVLVQVAEVIVHEEYGN--FLNDVALLRLESPLILSASIQPIDLPTVDTPADV-DVV 157
            |:......|.:.....:.:|..|.:  :.||:.||.|...:..:|..|.::|||...|... ::|
  Fly    83 GTIRYAEPGAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGASELV 147

  Fly   158 ISGWGRIKHQGDLPRYLQYNTLKSITRQQCEELIDFGFEGEL-----CLLHQVDNGACNGDSGGP 217
            .:|||.....|.||..||....:.:....||.::....:.||     |...|.:.|||:||||||
  Fly   148 FTGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGACHGDSGGP 212

  Fly   218 AVYNNQLVGVAGFVVDGCGSTYPDGYARVFYFKDWIKK 255
            .|:...|||:..|.|. |....||.:..:.|::||:::
  Fly   213 LVHQGTLVGILNFFVP-CAQGVPDIFMNIMYYRDWMRQ 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 73/229 (32%)
Tryp_SPc 32..256 CDD:238113 74/233 (32%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 74/233 (32%)
Tryp_SPc 27..246 CDD:214473 72/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I5856
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.