DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and CG16749

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:245 Identity:84/245 - (34%)
Similarity:129/245 - (52%) Gaps:32/245 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GRVVGGEDAVKNQFPHQVSLR-NAGSHSCGGSILTRTYILTAAHC-----VSNEDVNHVITPIAA 88
            ||||.|.|:...::|..:|:| ::|||||||||:::.:::|||||     .|:..|.:.:|.|.|
  Fly    28 GRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDGRKASDLSVQYGVTKINA 92

  Fly    89 ERFTIRAGSNDRFSGGVLVQVAEVIVHEE---YGNFLNDVALLRLESPLIL-SASIQPIDLP--- 146
                         :|..:|:|.::|.||:   |.|:.||::||.:|.|... ..::.|:.||   
  Fly    93 -------------TGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLPELA 144

  Fly   147 --TVDTPADVDVVISGWGRIKHQGDLPRYLQYNTLKSITRQQCEELIDFGFEGELCLLHQVDNGA 209
              |..|.|..:.|:.|||.....|.:...||...||..:.::|.|......:....:...||.|.
  Fly   145 FATPQTDAGGEGVLIGWGLNATGGYIQSTLQEVELKVYSDEECTERHGGRTDPRYHICGGVDEGG 209

  Fly   210 ---CNGDSGGPAVYNNQLVGVAGFVVDGCG-STYPDGYARVFYFKDWIKK 255
               |:||||||.:||.|.||:..:.:..|. :.||..|.:|..:.|||||
  Fly   210 KGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 79/240 (33%)
Tryp_SPc 32..256 CDD:238113 82/243 (34%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 79/240 (33%)
Tryp_SPc 30..259 CDD:238113 80/241 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.