DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and CG12951

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:264 Identity:86/264 - (32%)
Similarity:138/264 - (52%) Gaps:30/264 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SFLLFLVLPV----QSAPGKLNGRVVGGEDAVKNQFPHQVSLRN-AGSHSCGGSILTRTYILTAA 71
            |..|.::|.|    |:||.  ..|||.|.|:...::|..||||: .|||||||||:::.:::|||
  Fly     8 SLSLIVILAVTTVGQAAPS--ISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAA 70

  Fly    72 HCVSNEDVNHVITPIAAERFTIRAG-SNDRFSGGVLVQVAEVIVHEEYG---NFLNDVALLRLES 132
            ||.:..         .|:..:|:.| :|....|..:|.:.::|.||::.   ...||::||.:|.
  Fly    71 HCTNGR---------PADTLSIQFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEE 126

  Fly   133 PLIL-SASIQPIDLPTV-----DTPADVDVVISGWGRIKHQGDLPRYLQYNTLKSITRQQCEELI 191
            |... ..|:.|::||.:     .:.|.|:.|:.|||.....|.:...||..:||..:.::|....
  Fly   127 PFEFDGVSVAPVELPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSRH 191

  Fly   192 DFGFEGELCLLHQVDNGA---CNGDSGGPAVYNNQLVGVAGFVVDGCG-STYPDGYARVFYFKDW 252
            :...:.:..:...||.|.   |:||||||.:||.|.||:..:.:..|. :.||..|.:|..:.||
  Fly   192 NGQTDPKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDW 256

  Fly   253 IKKH 256
            ||.:
  Fly   257 IKSN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 76/236 (32%)
Tryp_SPc 32..256 CDD:238113 78/238 (33%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 76/236 (32%)
Tryp_SPc 30..260 CDD:238113 78/238 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.