DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and Tmprss11c

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:272 Identity:86/272 - (31%)
Similarity:129/272 - (47%) Gaps:59/272 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LPVQSAPGKLNG-----------RVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAH 72
            |.:.|:..|.:|           :|.||:||.:.::|.|.||:....|.||.::::.::::||||
  Rat   163 LLIDSSSFKFSGCGRRTITPGGHKVAGGQDAEEGEWPWQASLQQNNVHRCGATLISNSWLITAAH 227

  Fly    73 CVSNEDVNHVITPIAAERFTIRAGSND-RFSGGVLVQ-------VAEVIVHEEYG----NFLNDV 125
            |                 |...|...| :.|.|.|:.       |..:::||.|.    |  ||:
  Rat   228 C-----------------FVRSANPKDWKVSFGFLLSKPQAQRAVKSIVIHENYSYPAHN--NDI 273

  Fly   126 ALLRLESPLILSASIQPIDLP--TVDTPADVDVVISGWGRIKHQGDLPRYLQYNTLKSITRQQCE 188
            |::||.||::...:|:...||  |...|.:.|||::|||.:|..||.|..||...:|.|..:.|.
  Rat   274 AVVRLSSPVLYENNIRRACLPEATQKFPPNSDVVVTGWGTLKSDGDSPNILQKGRVKIIDNKTCN 338

  Fly   189 ELIDFG---FEGELC---LLHQVDNGACNGDSGGPAVYNNQ-----LVGVAGFVVDGCG-STYPD 241
            ....:|   ..|.||   |..:||  ||.||||||.|..:.     |.|:..: .|.|. ...|.
  Rat   339 SGKAYGGVITPGMLCAGFLEGRVD--ACQGDSGGPLVSEDSKGIWFLAGIVSW-GDECALPNKPG 400

  Fly   242 GYARVFYFKDWI 253
            .|.||.:::|||
  Rat   401 VYTRVTHYRDWI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 80/247 (32%)
Tryp_SPc 32..256 CDD:238113 82/248 (33%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699
Tryp_SPc 186..412 CDD:214473 80/247 (32%)
Tryp_SPc 187..415 CDD:238113 82/248 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.