DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and CG11037

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_649272.1 Gene:CG11037 / 40317 FlyBaseID:FBgn0037038 Length:292 Species:Drosophila melanogaster


Alignment Length:268 Identity:75/268 - (27%)
Similarity:125/268 - (46%) Gaps:39/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GKVAILLCSFLLFLVLPVQSAPGKLNGRVVGGEDAVKNQF-PHQVSLRNAGSHSCGGSILTRTYI 67
            ||...|..:.|..:|||   :|.:.  ||:||......:. .:..:|.......|||::|....:
  Fly    39 GKNLTLDVAQLAKIVLP---SPHET--RVIGGHVTTNAKLGGYLTALLYEDDFVCGGTLLNENIV 98

  Fly    68 LTAAHCVSNEDVNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEY--GNFLNDVALLRL 130
            ||||||        .:..:.|..:.:.||.::....|:...|.:.|:.|::  .:...|||::.|
  Fly    99 LTAAHC--------FLGRMKASEWIVAAGISNLNQKGIRRHVKDFILSEQFREDDMNMDVAVVLL 155

  Fly   131 ESPLILSASIQPIDLPTVDTPADVDVVISGWGRIKHQGDLPRYLQYNTLKSIT-----RQQCE-- 188
            ::|| .:.:|..:.|.:|.....|::|:||||....:|..|    :|.|:::|     ::.|.  
  Fly   156 KTPL-KAKNIGTLSLCSVSLKPGVELVVSGWGMTAPRGRGP----HNLLRTVTVPIIHKKNCRAA 215

  Fly   189 -----ELIDFGFEGELCLLHQVDNGACNGDSGGPAVYNNQLVGVAGFVVDGCGST-YPDGYARVF 247
                 ::.|    ..:|........||..|||||.|:..|:.|:..|.: ||.|. ||..|..|.
  Fly   216 YQPTAKITD----SMICAAVLGRKDACTFDSGGPLVFKKQVCGIVSFGI-GCASNRYPGVYTDVM 275

  Fly   248 YFKDWIKK 255
            |.|.:|:|
  Fly   276 YVKPFIEK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 65/237 (27%)
Tryp_SPc 32..256 CDD:238113 66/240 (28%)
CG11037NP_649272.1 Tryp_SPc 61..281 CDD:214473 65/237 (27%)
Tryp_SPc 62..283 CDD:238113 65/238 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.