DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and CG9372

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster


Alignment Length:261 Identity:72/261 - (27%)
Similarity:121/261 - (46%) Gaps:57/261 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RVVGGEDAVKNQFPHQVSLRNAGSHS--CGGSILTRTYILTAAHCV---SNEDV--------NHV 82
            |:.||..|..:::|...:|...|...  |||.::|..::||||||:   :.||:        .|:
  Fly   173 RLTGGRPAEPDEWPWMAALLQEGLPFVWCGGVLITDRHVLTAAHCIYKKNKEDIFVRLGEYNTHM 237

  Fly    83 ITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYG--NFLNDVALLRLESPLILSASIQPIDL 145
            :....|..|                ::|.:::|.:|.  |:.||:|::|::...|.:..|.|:.:
  Fly   238 LNETRARDF----------------RIANMVLHIDYNPQNYDNDIAIVRIDRATIFNTYIWPVCM 286

  Fly   146 PTVDTP-ADVDVVISGWGRIKHQG---------DLPRYLQYNTLKSITRQQCEELIDFGF-EGEL 199
            |.|:.. :|.:.:::|||..|..|         :||.:.|.:...|..:...:..:..|| ||  
  Fly   287 PPVNEDWSDRNAIVTGWGTQKFGGPHSNILMEVNLPVWKQSDCRSSFVQHVPDTAMCAGFPEG-- 349

  Fly   200 CLLHQVDNGACNGDSGGPAVYN--NQ---LVGVAGFVVDGCGST-YPDGYARVFYFKDWIKKHSD 258
                  ...:|.||||||.:..  ||   .:|:..:.| |||.. .|..|.||..:.|||..::|
  Fly   350 ------GQDSCQGDSGGPLLVQLPNQRWVTIGIVSWGV-GCGQRGRPGIYTRVDRYLDWILANAD 407

  Fly   259 V 259
            |
  Fly   408 V 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 68/253 (27%)
Tryp_SPc 32..256 CDD:238113 69/255 (27%)
CG9372NP_649132.1 CLIP 87..132 CDD:197829
Tryp_SPc 173..402 CDD:214473 68/253 (27%)
Tryp_SPc 176..402 CDD:238113 67/250 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457732
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.