DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and CG4613

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster


Alignment Length:241 Identity:74/241 - (30%)
Similarity:113/241 - (46%) Gaps:32/241 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHCVSNEDVNHVITPIAAERFTIRA 95
            |:|||.....|::|....:.......|||:::...|:|||||||...|:..|         ::|.
  Fly   136 RIVGGTQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCVHGMDMRGV---------SVRL 191

  Fly    96 GSNDRFSG--GVLVQVAEVIVHEEYG--NFLNDVALLRLESPLILSASIQPIDLPTVDTPADVD- 155
            ...||.|.  ||...||....|..|.  :.::|:|||||:.|:.|..:::|..||: :...:.| 
  Fly   192 LQLDRSSTHLGVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLPS-NWLQNFDF 255

  Fly   156 --VVISGWGRIKHQGDLPRYLQYNTLKSITRQQCEE------LIDFGFEGELCLLHQVDNG--AC 210
              .:::|||..:..|.....||...:..||..||..      ::|    ..:|..:....|  ||
  Fly   256 QKAIVAGWGLSQEGGSTSSVLQEVVVPIITNAQCRATSYRSMIVD----TMMCAGYVKTGGRDAC 316

  Fly   211 NGDSGGPAVYNNQLVGVAGFVVDGCGSTYPDG---YARVFYFKDWI 253
            .||||||.:..:::..:||.|..|.|...||.   |.||..:.:||
  Fly   317 QGDSGGPLIVRDRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 72/239 (30%)
Tryp_SPc 32..256 CDD:238113 73/240 (30%)
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 72/239 (30%)
Tryp_SPc 137..362 CDD:238113 71/238 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457780
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.