DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and CG32374

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster


Alignment Length:236 Identity:73/236 - (30%)
Similarity:118/236 - (50%) Gaps:25/236 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHC-VSNEDVNHVITPIAAERFTIR 94
            |:|.|:....::.|:|.:|.......||..||.|.:||||.|| :.|..           |:|:|
  Fly    73 RIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHCKIGNPG-----------RYTVR 126

  Fly    95 AGSNDRFSGGVLVQVAEVIVHEEYGNFL--NDVALLRLESPLILSASIQPIDLPTVDTPADVDVV 157
            |||..:..||.|..|.:.:.|..|..:.  ||:.:::|::||.:...:|.:.||:..|.......
  Fly   127 AGSTQQRRGGQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPSTRTKRFPKCY 191

  Fly   158 I-SGWGRIK-HQGDLPRYLQYNTLKSITRQQCEELIDFGFEG-----ELCLLHQVDNGACNGDSG 215
            : ||||... :..::.|||:...:..::|.:|::  |:...|     ::....:.:...|:||||
  Fly   192 LASGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQ--DYRGTGIKIYKQMICAKRKNRDTCSGDSG 254

  Fly   216 GPAVYNNQLVGVAGFVVDGCGST-YPDGYARVFYFKDWIKK 255
            ||.|:|..|.|:..|.: ||.|. ||..|..|..:..||||
  Fly   255 GPLVHNGVLYGITSFGI-GCASAKYPGVYVNVLQYTRWIKK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 69/232 (30%)
Tryp_SPc 32..256 CDD:238113 72/235 (31%)
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 69/232 (30%)
Tryp_SPc 74..295 CDD:238113 72/235 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.