DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and CG32277

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster


Alignment Length:289 Identity:75/289 - (25%)
Similarity:121/289 - (41%) Gaps:71/289 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILLCSFLLFLVLPVQSAPGKLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAH 72
            |||....|...|...|......|::.||:..:.......|:||..|...|||.|::...:|||||
  Fly     3 ILLIGLALLHQLEGSSLFTLRQGKIFGGKTTLVKDHSFLVNLRRGGKFRCGGVIISPNCVLTAAH 67

  Fly    73 CVSNEDVNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEY------------------- 118
            |:.                            |...||.::.||.:.                   
  Fly    68 CLE----------------------------GRYQQVRDLTVHAQQQCLGDDMPPEHVRSAWYVG 104

  Fly   119 --GNFL------NDVALLRLESPLILSASIQPIDLPTVDTPADVDVVISGWGRIKHQG-DLPRYL 174
              .|:.      :|:|::||..|..::.:...:.:...|.|...::.:.|||.|..|| :..:.|
  Fly   105 LSPNYCAQRGLDSDLAVIRLSRPFDIAGNASLVKIDYNDLPPHSNLTVLGWGAINEQGHNWNQCL 169

  Fly   175 QYNTLKSITRQQCEELIDFGFE----GELCLLHQVDNGACNGDSGGPAVYNNQLVGVA--GFVVD 233
            |...:|.|:.::|.:.:..|::    ...|.|.:....||.|||||||:|..:.||:.  |:   
  Fly   170 QEANVKLISHRECIKSVGSGWQKVTNNMFCALGKNARDACQGDSGGPAIYAGRSVGIVSWGY--- 231

  Fly   234 GCGSTYPDGYARV------FYFKDWIKKH 256
            ||||.||..|.|:      ::.||:|::|
  Fly   232 GCGSGYPGVYTRLSSPSITYWLKDFIERH 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 66/261 (25%)
Tryp_SPc 32..256 CDD:238113 67/263 (25%)
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 64/250 (26%)
Tryp_SPc 27..246 CDD:238113 64/249 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.