DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and CG32271

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster


Alignment Length:264 Identity:80/264 - (30%)
Similarity:114/264 - (43%) Gaps:46/264 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LFLVLPV----QSAPGKLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHCVS 75
            |:|||.:    .:|..:.|.|:|||........|:.|:||..|:..||||::|..:::||||||.
  Fly     4 LWLVLHLIPLCWAASNEANSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVK 68

  Fly    76 NEDVNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYG--NFLNDVALLRLESPLILSA 138
            .         |.|.|..:.||.......||...|.:|...:.|.  ...:|||:|:|::| |...
  Fly    69 G---------IGASRILVVAGVTRLTETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAP-ISGP 123

  Fly   139 SIQPIDLPTVDTPADVDVVISGWGRIKHQGD-------------LPR---YLQYNTLKSITRQQC 187
            .:..|:|......|...:.:||||:|..:..             :||   ..||....:||... 
  Fly   124 KVSTIELCNTSFKAGDLIKVSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITNTM- 187

  Fly   188 EELIDFGFEGELCLLHQVDNGACNGDSGGPAVYNNQLVGVAGFVVDGCG-STYPDGYARVFYFKD 251
                       .|........||.|||||||||..||.|:..:.| ||. .:.|..|..|...:.
  Fly   188 -----------FCASVPGVKDACEGDSGGPAVYQGQLCGIVSWGV-GCARKSSPGVYTNVKTVRS 240

  Fly   252 WIKK 255
            :|.|
  Fly   241 FIDK 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 72/240 (30%)
Tryp_SPc 32..256 CDD:238113 73/243 (30%)
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 72/240 (30%)
Tryp_SPc 25..244 CDD:238113 72/241 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.