DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and CG13430

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster


Alignment Length:245 Identity:84/245 - (34%)
Similarity:125/245 - (51%) Gaps:34/245 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHCVSNEDVNHVITPIAAERFTI 93
            :||:|||.:.....|||||||:....|:|||:|::...|||||||        |:.....:.:.|
  Fly    29 DGRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTAAHC--------VLEYSKPQYYVI 85

  Fly    94 RAGSNDRFSGGVLVQVAEVIVHEEYGN---FLNDVALLRLESPLILSASIQPIDLPT---VDTPA 152
            ||||:|...||..::|.::|.|.|:.:   ..||:|:::|:.||:.|..|:||.|.|   :..|.
  Fly    86 RAGSSDWTKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRPISLATSKDIIMPT 150

  Fly   153 DVDVVISGWGRIK-HQGDLPRYLQYNTLKSITRQQCEELIDFGFEGEL-----CLLHQV-DNGAC 210
             ..:.:||||... .|....:.|:|..:....:.||.... || .|.:     |...|. ...:|
  Fly   151 -AQLFVSGWGSTSISQMQPEKRLRYTVVHLRDQNQCARNY-FG-AGTVTNTMFCAGTQAGGRDSC 212

  Fly   211 NGDSGGPAVYN----NQLVGVA--GFVVDGCGST-YPDGYARVFYFKDWI 253
            .||||||.|.:    .:|.|:.  ||   ||.:. :|..|.:|..:.|||
  Fly   213 QGDSGGPLVTSIDGRLKLYGIVSWGF---GCANAMFPGIYTKVSAYDDWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 81/241 (34%)
Tryp_SPc 32..256 CDD:238113 82/242 (34%)
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 81/241 (34%)
Tryp_SPc 32..262 CDD:238113 82/242 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.