DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and CG11192

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster


Alignment Length:274 Identity:85/274 - (31%)
Similarity:130/274 - (47%) Gaps:46/274 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FLLFLVLPVQSAPGKLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHCVSNE 77
            :|:.||....:.|...:||:||||.|...:||:|||::..|.|.|||:|:....:||||||.  |
  Fly     9 WLMALVAYAGATPTPGDGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCF--E 71

  Fly    78 DVNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYG--NFLNDVALLRLESPLILSASI 140
            |      |.::..:|:|.||::..|||.::.:..||.|.:|.  :..||:|||.|...|..:..:
  Fly    72 D------PWSSADYTVRVGSSEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHL 130

  Fly   141 QPIDLPTVDTP--ADVDVVISGWG------RIKHQGDLPRYLQYNTLKSITRQQCEELIDFGFEG 197
            ||:.|..:..|  ||..:.:||||      .:..:..:...|::..:..:...||..    .:..
  Fly   131 QPVPLAALADPPTADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRR----AYSQ 191

  Fly   198 ELCLLHQV------DNGACNGDSGGPAVYNNQLVGVA---------GFVVDGCG---STYPDGYA 244
            .|.:..::      ...:|.||||||      |||.|         |.|..|.|   ..:|..|.
  Fly   192 VLPITRRMICAARPGRDSCQGDSGGP------LVGYAAEEGPARLYGIVSWGLGCANPNFPGVYT 250

  Fly   245 RVFYFKDWIKKHSD 258
            .|..|:.||.:..|
  Fly   251 NVAAFRSWIDEQLD 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 77/249 (31%)
Tryp_SPc 32..256 CDD:238113 78/251 (31%)
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 77/249 (31%)
Tryp_SPc 28..262 CDD:238113 78/251 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.