DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and CG8299

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster


Alignment Length:271 Identity:87/271 - (32%)
Similarity:131/271 - (48%) Gaps:32/271 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VAILLCSFLLF---LVLPVQSAPGKLNGRVVGGEDAVKNQFPHQVSLRNAG---SHSCGGSILTR 64
            :::.|..|||.   :|:...||  .::..:|||:.|....||:|||:|...   .|.|||||...
  Fly     1 MSLRLGLFLLAALGVVILTDSA--SISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAP 63

  Fly    65 TYILTAAHCVSNEDVNHVITPIAAERFTIRAGSN---DRFSGGVLVQVAEVIVHEEYG--NFLND 124
            ..::|||||:.....:::         .|.||.|   |....|  |:|:::|.|..|.  .::||
  Fly    64 RVVITAAHCIKGRYASYI---------RIVAGQNSIADLEEQG--VKVSKLIPHAGYNKKTYVND 117

  Fly   125 VALLRLESPLILSASIQPIDLPTVDTPADVDVVISGWG-RIKHQGDLPRYLQYNTLKSITRQQCE 188
            :.|:....||..||.:|||.:.....|:....|:|||| |.:....||..|:...|:.|.:..|.
  Fly   118 IGLIITREPLEYSALVQPIAVALEAPPSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCG 182

  Fly   189 ELI---DFGFEGELCLLHQVDNG--ACNGDSGGPAVYNNQLVGVAGFVVDGCG-STYPDGYARVF 247
            ...   |:....|:.....::.|  .||||||||...:..||||..:.| ||| ..:|..|..|.
  Fly   183 AQYLTKDYTVTDEMLCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSWGV-GCGREGFPGVYTSVN 246

  Fly   248 YFKDWIKKHSD 258
            ...|||::.::
  Fly   247 SHIDWIEEQAE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 78/236 (33%)
Tryp_SPc 32..256 CDD:238113 80/238 (34%)
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 78/236 (33%)
Tryp_SPc 28..255 CDD:238113 80/238 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.