DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and Prss3

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001102096.1 Gene:Prss3 / 362347 RGDID:1311446 Length:246 Species:Rattus norvegicus


Alignment Length:272 Identity:85/272 - (31%)
Similarity:123/272 - (45%) Gaps:66/272 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLFLVL-------PVQSAPGKLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAA 71
            ||||.|       ||..     :.::|||....:|..|:|||| |:|.|.||||::...::::||
  Rat     4 LLFLALVGVAVAFPVDD-----DDKIVGGYTCQENSVPYQVSL-NSGYHFCGGSLINDQWVVSAA 62

  Fly    72 HCVSNEDVNHVITPIAAERFTIRAG--------SNDRFSGGVLVQVAEVIVHEEYG--NFLNDVA 126
            ||...             |..:|.|        .:::|     |..|::|.|..:.  |..||:.
  Rat    63 HCYKT-------------RIQVRLGEHNINVLEGDEQF-----VNAAKIIKHPNFNARNLNNDIM 109

  Fly   127 LLRLESPLILSASIQPIDLPTVDTPADVDVVISGWGRIKHQG-DLPRYLQYNTLKSITRQQCE-- 188
            |::|.||:.|:|.:..:.||:...||....:|||||.....| :.|..||......:.:..||  
  Rat   110 LIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSLGVNNPDLLQCLDAPVLPQADCEAS 174

  Fly   189 -------ELIDFGF-EGELCLLHQVDNGACNGDSGGPAVYNNQLVGVA--GFVVDGCG-STYPDG 242
                   .:|..|| ||        ...:|.||||||.|.|.||.|:.  |:   ||. ...|..
  Rat   175 YPGKITNNMICVGFLEG--------GKDSCQGDSGGPVVCNGQLQGIVSWGY---GCALKDNPGV 228

  Fly   243 YARVFYFKDWIK 254
            |.:|..:.|||:
  Rat   229 YTKVCNYVDWIQ 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 76/245 (31%)
Tryp_SPc 32..256 CDD:238113 78/247 (32%)
Prss3NP_001102096.1 Tryp_SPc 23..239 CDD:214473 76/245 (31%)
Tryp_SPc 24..242 CDD:238113 78/247 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.