DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and lambdaTry

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster


Alignment Length:265 Identity:92/265 - (34%)
Similarity:130/265 - (49%) Gaps:39/265 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLFLVLPVQSAPG------------KLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTY 66
            ::||||.|..:..            ||:||:|||:|....|:|||:|:|..|:|.|||:|.....
  Fly     6 VVFLVLGVGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQ 70

  Fly    67 ILTAAHCVSNEDVNHVITPIAAERFTIRAG-SNDRFSGGVL--VQVAEVIVHEEYGNFLN--DVA 126
            |::|||||:        |....|..||.|| ||..|..|..  ::|.|:|:|.:|....|  |.|
  Fly    71 IISAAHCVN--------TLSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKYRTLNNDYDAA 127

  Fly   127 LLRLESPLILSASIQPIDL----PTVDTPADVDVVISGWGRIKHQGDLPRYLQYNTLKSITRQQC 187
            :|.|:.....:.::|||:|    |..|||    |.::|||.....|.:...||..::..:....|
  Fly   128 ILILDGDFEFNDAVQPIELAKERPDHDTP----VTVTGWGTTSEGGTISDVLQEVSVNVVDNSNC 188

  Fly   188 EELIDFGFEGELCLLHQVDNG---ACNGDSGGPAVYNNQLVGVAGFVVDGCG-STYPDGYARVFY 248
            :..........: |...|:.|   ||.||||||.||||.|:|:..:.. ||. ..||..|..|..
  Fly   189 KNAYSIMLTSRM-LCAGVNGGGKDACQGDSGGPLVYNNTLLGIVSWGT-GCAREKYPGVYCSVPD 251

  Fly   249 FKDWI 253
            ..||:
  Fly   252 VLDWL 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 83/234 (35%)
Tryp_SPc 32..256 CDD:238113 83/235 (35%)
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 82/233 (35%)
Tryp_SPc 36..259 CDD:238113 83/235 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.