DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and CG17571

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster


Alignment Length:245 Identity:86/245 - (35%)
Similarity:122/245 - (49%) Gaps:33/245 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GRVVGGEDAVKNQFPHQVSLRNA-GSHSCGGSILTRTYILTAAHCVSNEDVNHVITPIAAERFTI 93
            ||:|.|||.....:|:|||::.. |||.||||::....:||||||:.:         .||....:
  Fly    29 GRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVLTAAHCMQS---------YAASELQV 84

  Fly    94 RAGSNDRFSGGVLVQVAEVIVHEEYGN--FLNDVALLRLESPLILSASIQPIDLPTVDTPADVDV 156
            |.||..|.|||.:|.|.....||.|.:  .:||||:::|.||:..::.|:.|:|...:..:..:.
  Fly    85 RVGSTSRSSGGEVVTVRAFKYHEGYNSKLMINDVAIIKLSSPVRQTSKIRAIELADSEAVSGTNA 149

  Fly   157 VISGWGRI------------KHQGDLPRYLQYNTLKSITRQQCEELIDFGFEGELCLLHQVDNGA 209
            |:||||..            |.:.||   |.|....:.|.....:.|   .|..:|...: ...|
  Fly   150 VVSGWGTTCFLFCSSPDTLQKVEVDL---LHYKDCAADTYNYGSDSI---LETMVCATGE-KKDA 207

  Fly   210 CNGDSGGPAVYNNQLVGVAGFVVDGCGST-YPDGYARVFYFKDWIKKHSD 258
            |.||||||.|.:|:||||..: ..||..| ||..||.|...:.||...:|
  Fly   208 CQGDSGGPLVADNKLVGVVSW-GSGCAWTGYPGVYADVASLRSWIVDTTD 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 82/237 (35%)
Tryp_SPc 32..256 CDD:238113 83/239 (35%)
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 82/237 (35%)
Tryp_SPc 31..254 CDD:238113 83/239 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.