DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and Phae2

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster


Alignment Length:271 Identity:74/271 - (27%)
Similarity:118/271 - (43%) Gaps:45/271 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LCSFLLFLVLPVQSAPGKLN---GRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAA 71
            |.:.||..|...|.:...|:   ||||||:.|..|..|:.||::..|:|.|..:|:...:::|||
  Fly     7 LATILLLAVCVSQGSGLALDQPEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTAA 71

  Fly    72 HCVSNEDVNHVITPIAAERFTIRAGSNDRFSGGVLV----------QVAEVIVHEEY--GNFLND 124
            ||::|.  |.|:..      |:.|||       :.|          |:...::::.|  |....|
  Fly    72 HCLANR--NQVLGS------TLVAGS-------IAVAGTASTTQKRQITHYVINDLYTGGTVPYD 121

  Fly   125 VALLRLESPLILSASIQPIDLPTVDTPADVDVVISGWGRIK--HQGDLPRYLQ-YNTLKSITRQQ 186
            :.|:...:....:|::.|:.||:..........:.|||...  :....|:.|| ...:..|:...
  Fly   122 IGLIYTPTAFTWTAAVAPVKLPSSGVRPTGKADLFGWGSTSKTNSPSYPKTLQEAKNIPIISLDS 186

  Fly   187 CEELIDFGFEGE------LCLLHQVDNGA--CNGDSGGPAVYNNQLVGVAGFVVDGCGS-TYPDG 242
            |...:  |.:|:      || ...:..|.  |..|||||.|..|.|:|:..:....||. ..|..
  Fly   187 CAAAL--GSKGQDVHTTNLC-TGPLTGGTSFCTSDSGGPLVQGNVLIGIVSWGKLPCGQPNSPSV 248

  Fly   243 YARVFYFKDWI 253
            |.:|..|..||
  Fly   249 YVQVSSFITWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 65/245 (27%)
Tryp_SPc 32..256 CDD:238113 66/246 (27%)
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 65/245 (27%)
Tryp_SPc 32..262 CDD:238113 66/246 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.