DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and CG5390

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster


Alignment Length:264 Identity:78/264 - (29%)
Similarity:118/264 - (44%) Gaps:56/264 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KLNGRVVGGEDAVKNQFPHQVS-LRNAGS---HSCGGSILTRTYILTAAHCVSNEDVNHVITPIA 87
            |:.|.|  .::|...:||..:: ||..|:   :.|||:::....:|||||||.|:..:.::    
  Fly   146 KITGAV--NQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIV---- 204

  Fly    88 AERFTIRAGS------------NDRFSGGVLVQVAEVIVHEEY--GNFLNDVALLRLESPLILSA 138
                 :|||.            .||:       |.|:|.||::  |:..||||::.||||..|..
  Fly   205 -----VRAGEWDTQTQTEIRRHEDRY-------VKEIIYHEQFNKGSLYNDVAVMLLESPFTLQE 257

  Fly   139 SIQPIDLPTVDTPADVD-VVISGWGRIK--HQGDLPRYLQYNTLKSITRQQCEELIDFGFEGELC 200
            :||.:.||.|....|.| ...:|||:.|  ..|:....|:...:..:..||||..:.....|...
  Fly   258 NIQTVCLPNVGDKFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHF 322

  Fly   201 LLH--------QVDNGACNGDSGGPAV-----YNNQL--VGVAGFVVDGCGS-TYPDGYARVFYF 249
            :||        :.|...|.||.|.|.|     ..|:.  .|:..:.: |||. ..|..||.|...
  Fly   323 ILHDSFICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGI-GCGEVNIPGVYASVAKL 386

  Fly   250 KDWI 253
            :.||
  Fly   387 RPWI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 74/258 (29%)
Tryp_SPc 32..256 CDD:238113 76/259 (29%)
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 75/255 (29%)
Tryp_SPc 153..390 CDD:214473 73/253 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457442
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.