DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and Try29F

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster


Alignment Length:246 Identity:81/246 - (32%)
Similarity:121/246 - (49%) Gaps:28/246 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHCVSNEDVNHVITPIAAERF 91
            :|:||:|||:.|.....|:||||:.: .|.||||::.:.::||||||....         |....
  Fly    37 RLDGRIVGGQVANIKDIPYQVSLQRS-YHFCGGSLIAQGWVLTAAHCTEGS---------AILLS 91

  Fly    92 TIRAGSNDRFSGGVLVQVAEVIVHEEYGNFL--NDVALLRLESPLILSASIQPIDLPTVDTPADV 154
            .:|.||:....||.||.:..|..|.::..:.  .|.:||.||.....:.:...:.||..|  ||:
  Fly    92 KVRIGSSRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQD--ADI 154

  Fly   155 ----DVVISGWGRIKHQGDLPRYLQYNTLKSITRQQCEELI-DFG--FEGELCL-LHQVDNGACN 211
                .|::||||..:...:....|:..|:..:::.||.|.. :||  .:..||. |.:....||.
  Fly   155 ADGTPVLVSGWGNTQSAQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGGKDACQ 219

  Fly   212 GDSGGPAVYNNQLVGVA--GFVVDGCG-STYPDGYARVFYFKDWIKKHSDV 259
            ||||||...:..|.||.  |:   ||. ..||..|:||...:|||...|.:
  Fly   220 GDSGGPLAADGVLWGVVSWGY---GCARPNYPGVYSRVSAVRDWISSVSGI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 76/234 (32%)
Tryp_SPc 32..256 CDD:238113 77/236 (33%)
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 76/234 (32%)
Tryp_SPc 42..264 CDD:238113 77/236 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.