DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and CG3355

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster


Alignment Length:245 Identity:94/245 - (38%)
Similarity:125/245 - (51%) Gaps:31/245 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RVVGGEDAVKNQFPHQVSLRNAGSH----SCGGSILTRTYILTAAHCV-SNEDVNHVITPIAAER 90
            |:|||:....|::|....|.. |.|    .||||::...|:||||||| .|.|           :
  Fly    75 RIVGGQQVRSNKYPWTAQLVK-GRHYPRLFCGGSLINDRYVLTAAHCVHGNRD-----------Q 127

  Fly    91 FTIRAGSNDRFS--GGVLVQVAEVIVHEEY--GNFLNDVALLRLESPLILSASIQPIDLPTVDTP 151
            .|||....||.|  .|::.:|.:..||..|  ...:||||||:||||:.|:.:::|:.||..:..
  Fly   128 ITIRLLQIDRSSRDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEANHN 192

  Fly   152 AD-VDVVISGWGRIKHQGDLPRYLQYNTLKSITRQQCEE--LIDFGFEGELC--LLHQVDNGACN 211
            .| ...|::|||.||..|....|||...:..||..||.:  ..|...|..||  |:.|....||.
  Fly   193 FDGKTAVVAGWGLIKEGGVTSNYLQEVNVPVITNAQCRQTRYKDKIAEVMLCAGLVQQGGKDACQ 257

  Fly   212 GDSGGPAVYNN---QLVGVAGFVVDGCG-STYPDGYARVFYFKDWIKKHS 257
            ||||||.:.|.   :|.||..|.. ||. ...|..||||..|.|||:|::
  Fly   258 GDSGGPLIVNEGRYKLAGVVSFGY-GCAQKNAPGVYARVSKFLDWIRKNT 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 91/239 (38%)
Tryp_SPc 32..256 CDD:238113 92/241 (38%)
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 91/239 (38%)
Tryp_SPc 76..305 CDD:238113 92/241 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457776
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.