DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and CG40160

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster


Alignment Length:280 Identity:76/280 - (27%)
Similarity:113/280 - (40%) Gaps:60/280 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PVQSAPGKLNG---RVVGGED----------AVKNQFPHQVSLRNAG--SHSCGGSILTRTYILT 69
            |:...|.:..|   |..||.|          |...:||..|:|.::|  |:.|.||::.:..:||
  Fly   140 PLDQRPNQPRGCGVRNTGGLDFTLSGVSQNEAGFGEFPWTVALLHSGNLSYFCAGSLIHKQVVLT 204

  Fly    70 AAHCVSNEDVNHVITPIAAERFTIRAGSNDRFSGGVLV-----QVAEVIVHEEYG--NFLNDVAL 127
            |||||.:         :....||:|||..|..:....:     .|..||:|.:|.  :...|.||
  Fly   205 AAHCVES---------LRTGSFTVRAGEWDTQTMKERLPYQERSVQTVILHPDYNRRSIAYDFAL 260

  Fly   128 LRLESPLILSASIQPIDLPTV-DTPADVDVVIS-GWGRIKHQGDLPRY-----------LQYNTL 179
            :.|..|:.|...|..|.||.. |.|...:...| |||:... |.|.:|           :::|:.
  Fly   261 VILSQPVTLDDHINVICLPQQDDIPQPGNTCFSTGWGKDAF-GSLGKYSSLMKRVPLPIVEFNSC 324

  Fly   180 KSI---TRQQCEELIDFGFEGELCLLHQVDNGACNGDSGGPAV--------YNNQLVGVAGFVVD 233
            ::.   ||...:..:|..|   :|...|.....|.||.|.|..        ...|..|:..:.: 
  Fly   325 QTRLRGTRLGPKFALDRSF---ICAGGQRGIDTCQGDGGAPLACPRGSTRESRYQQTGIVAWGI- 385

  Fly   234 GCGSTYPDGYARVFYFKDWI 253
            ||....|..||.|...:.||
  Fly   386 GCNDEVPAAYANVALVRGWI 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 71/264 (27%)
Tryp_SPc 32..256 CDD:238113 72/265 (27%)
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 69/254 (27%)
Tryp_SPc 169..405 CDD:214473 67/249 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457570
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.