DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and CG3117

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster


Alignment Length:271 Identity:79/271 - (29%)
Similarity:121/271 - (44%) Gaps:58/271 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SAPGKLNGR-VVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHCVSNEDVNHVITPI 86
            |.|..|:|. .|.|:....||||...:|...||:..|||::|...:|||||.::....|.::   
  Fly    82 SYPNALDGSPQVFGDQTKPNQFPWVTALFAKGSYLGGGSLITPGLVLTAAHILAGLSPNDIM--- 143

  Fly    87 AAERFTIRAG-----SNDRFSGGVLVQVAEVIVHE--EYGNFLNDVALLRLESPLILSASIQPID 144
                  :|||     |:::.:..:..||.:::.||  .|.:..||:|||.|:||..|.|:||.|.
  Fly   144 ------VRAGEWDLSSSEKLNPPMDRQVIKIMEHEAFNYSSGANDLALLFLDSPFELRANIQTIR 202

  Fly   145 LPTVDTPADVDV-VISGWG----------RIKHQGDLP--------RYLQYNTLKSITRQQCEEL 190
            ||..|...|..: .::|||          .|:.:.|||        |.|:...:.|..:.....:
  Fly   203 LPIPDKTFDRRICTVAGWGMRSSTDVDIQTIQQKVDLPVVESSKCQRQLRLTKMGSNYQLPASLM 267

  Fly   191 IDFGFEG-ELCLLHQVDNGACNGDSGGPAVY--------NNQLVGVAGFVVDGCG-STYPDGYAR 245
            ...|.|| ::|.|.           ||.|::        ..:..|:..|.| ||| :..|..:..
  Fly   268 CAGGEEGRDVCSLF-----------GGFALFCSLDDDPNRYEQAGIVSFGV-GCGQANVPTTFTH 320

  Fly   246 VFYFKDWIKKH 256
            |..|.:||..|
  Fly   321 VSKFMEWINPH 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 72/258 (28%)
Tryp_SPc 32..256 CDD:238113 74/259 (29%)
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 72/254 (28%)
Tryp_SPc 95..328 CDD:214473 71/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457606
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.