DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and CG4271

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster


Alignment Length:250 Identity:85/250 - (34%)
Similarity:132/250 - (52%) Gaps:30/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LVLPVQSAPGKLNGRVVGGEDAVKNQFPHQVSLRN---AGSHSCGGSILTRTYILTAAHCVSNED 78
            |:|..:|:.|..||        |:.:|.....|.:   :|.|.|||:::....:||||.||.|:.
  Fly     9 LILFARSSNGIYNG--------VEAKFDFWTFLASVWVSGYHECGGAVIDSRIVLTAAQCVKNKP 65

  Fly    79 VNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNFLNDVALLRLESPLILSASIQPI 143
            |         :|.|:|.|:.|.:.||.:::|..::|||.|.|:.||:|||.||.| :||..:..|
  Fly    66 V---------KRITVRVGTPDIYRGGRIIRVTALVVHENYKNWDNDIALLWLEKP-VLSVRVTKI 120

  Fly   144 DLPTVDTPADVDVVISGWG-RIKHQGDLPRYLQYNTLKSITRQQC-EELIDFGFEGELCLLHQVD 206
            .|.|.:...:.....:||| ::.....:.|.||....|...|..| |||::...|..||..: .:
  Fly   121 PLATKEPSENEYPSNAGWGEKLLESYVVTRKLQNGVTKIRPRSMCAEELVEPVGEELLCAFY-TE 184

  Fly   207 NGACNGDSGGPAVYNNQLVGVA--GFVVDGCG-STYPDGYARVFYFKDWIKKHSD 258
            |..|.||.|||.|..|::||:|  |   .||| :..|..|..||::.:||:::::
  Fly   185 NDICPGDYGGPLVLANKVVGIAVQG---HGCGFAVLPSLYTNVFHYLEWIEENAE 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 77/229 (34%)
Tryp_SPc 32..256 CDD:238113 79/231 (34%)
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 81/236 (34%)
Tryp_SPc 19..231 CDD:214473 79/233 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004525
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.