DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and CG4259

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster


Alignment Length:204 Identity:50/204 - (24%)
Similarity:85/204 - (41%) Gaps:50/204 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GSILTRTYILTAAHCVSNEDVNHVITPIAAERFTIRAGSNDRFSGG----VLVQVAEVIVHEEYG 119
            ||::....:|||||.::......::         :|||..|..:..    |.::|..::.||::.
  Fly    59 GSLINPNVVLTAAHILNGTTKYDLV---------VRAGEWDTSTTADQQHVDLEVLNIVSHEQFN 114

  Fly   120 NF--LNDVALLRLESPLILSASIQPIDLPTVDTPADV-DVVISGWGRI-KHQGDLPRYLQYNTLK 180
            .|  .|::|||.|.|...::|:|..|.|...:..... ....:|||:: .:..|.|..|:...:.
  Fly   115 RFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQKGSCFFNGWGKVYLNSTDYPTVLKTVQVD 179

  Fly   181 SITRQQC-------EELIDFGFEGELCLLHQVDNGACNGDSGGPAVYNNQLVGVAGFVVDGCG-S 237
            .::...|       :::...|.||       :|   |:||.|.|.|               |. .
  Fly   180 LLSMGMCSSRKLPIQQICGKGLEG-------ID---CSGDGGAPLV---------------CRIL 219

  Fly   238 TYPDGYARV 246
            |||..||:|
  Fly   220 TYPYKYAQV 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 50/204 (25%)
Tryp_SPc 32..256 CDD:238113 50/204 (25%)
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 50/204 (25%)
Tryp_SPc 39..256 CDD:214473 50/204 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457564
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.