DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and CG11911

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster


Alignment Length:281 Identity:82/281 - (29%)
Similarity:129/281 - (45%) Gaps:52/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILLCSFLLFLVLPVQSA----------PGKLNGRVVGGEDAVKNQFPHQVSLRN---AGSHSCGG 59
            ::..:.::.||...|.|          |....|.|:.|.:|..:..|:.|||..   ..||.|||
  Fly     3 LITVTLVIALVAAAQGAKLSDKLAKLVPSFATGFVINGTEAEPHSAPYIVSLATNYLKHSHICGG 67

  Fly    60 SILTRTYILTAAHCVSNEDVNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEV---IVHEEYGNF 121
            :::.:.:|:|||||:|.        |:.   .:|.||.:.|.....|.|..:|   .|||:|...
  Fly    68 TLINKDWIVTAAHCISE--------PVG---MSIIAGLHTRAEVDELTQQRQVDFGRVHEKYTGG 121

  Fly   122 LN--DVALLRLESPLILSASIQPIDLPTVDTPADVDVVISGWGRIKHQGDLPRYL--QYNTLKSI 182
            :.  |:|||.:....|.:..:||..||:.:...:.:..:.|||:.|      .|:  ...||:::
  Fly   122 VGPYDIALLHVNESFIFNEWVQPATLPSREQVHEGETHLYGWGQPK------SYIFSGAKTLQTV 180

  Fly   183 TRQ-----QC-EELIDFG--FEGELCLLH-QVDNGACNGDSGGPAVYN-----NQLVGVAGFVVD 233
            |.|     :| |||.:..  .|..:|... |....|||||||||.|..     ::|:|:..:...
  Fly   181 TTQILNYEECKEELPESAPIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSWGYI 245

  Fly   234 GCG-STYPDGYARVFYFKDWI 253
            .|| :..|..|.:|..:.|||
  Fly   246 PCGLANMPSIYTKVSAYIDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 74/246 (30%)
Tryp_SPc 32..256 CDD:238113 76/247 (31%)
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 76/247 (31%)
Tryp_SPc 37..266 CDD:214473 74/245 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.