DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and CG1304

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:255 Identity:211/255 - (82%)
Similarity:231/255 - (90%) Gaps:0/255 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KVAILLCSFLLFLVLPVQSAPGKLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILT 69
            |.||||.||||.|.:||.||||.|||||||||||||||||||||||||||||||||||:|.|:||
  Fly     5 KAAILLGSFLLLLAVPVHSAPGSLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLT 69

  Fly    70 AAHCVSNEDVNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNFLNDVALLRLESPL 134
            |||||:|:|.|....||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly    70 AAHCVTNQDSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNFLNDVALLRLESPL 134

  Fly   135 ILSASIQPIDLPTVDTPADVDVVISGWGRIKHQGDLPRYLQYNTLKSITRQQCEELIDFGFEGEL 199
            |||||||||||||.||||||||:|||||||||||||||||||||||||:.::|:|||.:|.:.||
  Fly   135 ILSASIQPIDLPTADTPADVDVIISGWGRIKHQGDLPRYLQYNTLKSISLERCDELIGWGVQSEL 199

  Fly   200 CLLHQVDNGACNGDSGGPAVYNNQLVGVAGFVVDGCGSTYPDGYARVFYFKDWIKKHSDV 259
            ||:|:.||||||||||||||||||:|||||||...||::||||||||:|..:|||.:|||
  Fly   200 CLIHEADNGACNGDSGGPAVYNNQVVGVAGFVWSACGTSYPDGYARVYYHNEWIKNNSDV 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 186/221 (84%)
Tryp_SPc 32..256 CDD:238113 188/223 (84%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 186/221 (84%)
Tryp_SPc 32..256 CDD:238113 188/223 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473221
Domainoid 1 1.000 117 1.000 Domainoid score I5856
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H114140
Inparanoid 1 1.050 201 1.000 Inparanoid score I6178
Isobase 1 0.950 - 0 Normalized mean entropy S7244
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D121264at33392
OrthoFinder 1 1.000 - - FOG0004525
OrthoInspector 1 1.000 - - otm47449
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13627
1211.960

Return to query results.
Submit another query.