DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and Prss53

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001074737.1 Gene:Prss53 / 330657 MGIID:2652890 Length:552 Species:Mus musculus


Alignment Length:269 Identity:67/269 - (24%)
Similarity:102/269 - (37%) Gaps:61/269 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QSAPG---KLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHCVSNEDVNHVI 83
            |..||   ...|..:.||      :|.|.|:|..|.|.|.||::..|::||||||...      :
Mouse    30 QRGPGPPEPQEGNTLPGE------WPWQASVRRQGVHICSGSLVADTWVLTAAHCFEK------M 82

  Fly    84 TPIAAERFTIRAGS---NDRFSGGVLVQVAEVIVHEEYGNFL--NDVALLRLESPLILSASIQPI 143
            .......:::..||   ..:..|...|.||.:.:.:.|.::.  :|:|||:|..|.:.:....| 
Mouse    83 ATAELSSWSVVLGSLKQEGQSPGAEEVGVAALQLPKAYNHYSQGSDLALLQLTHPTVQTTLCLP- 146

  Fly   144 DLPTVDTPADVDVVISGWGRIKHQGDLPRYLQYNTLKSITRQQCEELIDFGFEGELCL---LHQ- 204
             .||...|.......:||.  ::..|:.|.|:...|:.|:|..|.           ||   ||| 
Mouse   147 -QPTYHFPFGASCWATGWD--QNTSDVSRTLRNLRLRLISRPTCN-----------CLYNRLHQR 197

  Fly   205 -----------------VDNGACNGDSGGPAVYNNQ-----LVGVAGFVVDGCGSTYPDGYARVF 247
                             .:.|.|.||||||.:....     .||:..|.........|.....:.
Mouse   198 LLSNPARPGMLCGGAQPGEQGPCQGDSGGPVMCREPDGHWVQVGIISFTSKCAQEDTPVLLTDMA 262

  Fly   248 YFKDWIKKH 256
            ....|::.|
Mouse   263 VHSSWLQAH 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 61/252 (24%)
Tryp_SPc 32..256 CDD:238113 62/254 (24%)
Prss53NP_001074737.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..46 4/15 (27%)
Tryp_SPc 45..271 CDD:238113 62/252 (25%)
Tryp_SPc 311..522 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.