DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and CG9672

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster


Alignment Length:232 Identity:80/232 - (34%)
Similarity:124/232 - (53%) Gaps:11/232 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHCVSNEDVNHVITPIAAERFTIR 94
            ||:.||||||..|.|:|.:|...||::||..|:.:.|.|||..||.::..:   ||.||..|.:.
  Fly    23 GRIAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYALTALSCVCSDGKD---TPWAAVLFAVT 84

  Fly    95 AGSNDRFSGGVLVQVAEVIVHEEYGNFLNDVALLRLESPLILSASIQPIDLPTVDTPADVDVVIS 159
            .||.|.:: |..::|.|:.::..|......:|||||:..:..|.::..|.|.....|....|.:|
  Fly    85 VGSVDLYN-GKQIRVEEITINPNYSTLKTGIALLRLQEEITFSETVNAIPLSQDVPPMGSQVEVS 148

  Fly   160 GWGR-IKHQGDLPRYLQYNTLKSITRQQC-----EELIDFGFEGELCLLHQVDNGACNGDSGGPA 218
            |||| .:.:.::.|.||....:.:..::|     :||: ...:..|||.|....|.|:||.||||
  Fly   149 GWGRTTESEVNMHRTLQIGAAEVMAPRECALANRDELL-VADDQVLCLGHGRRQGICSGDIGGPA 212

  Fly   219 VYNNQLVGVAGFVVDGCGSTYPDGYARVFYFKDWIKK 255
            ||..||||:...::..||...|:.:..:....|||::
  Fly   213 VYQGQLVGLGAQILGECGGMLPERFISIAANYDWIQQ 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 77/227 (34%)
Tryp_SPc 32..256 CDD:238113 78/230 (34%)
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 77/227 (34%)
Tryp_SPc 25..250 CDD:238113 78/230 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D138113at50557
OrthoFinder 1 1.000 - - FOG0004525
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.