DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and CG4653

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster


Alignment Length:260 Identity:102/260 - (39%)
Similarity:143/260 - (55%) Gaps:30/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SFLLFLVL-----PVQSA--PGKLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILT 69
            |.||.||:     .|||:  |.:     ||.:       ||.:|||..|.|.|||:::...:|||
  Fly    10 SRLLLLVVIVTLGVVQSSRLPAE-----VGSQ-------PHSISLRRNGVHVCGGALIREKWILT 62

  Fly    70 AAHCVSNEDVNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNF----LNDVALLRL 130
            ||||||   :........|:.:.:|.||..|.:||.||.::::|:|..|.:.    .||:|||.|
  Fly    63 AAHCVS---LGGGQQSYPAKSYNVRVGSIQRLTGGQLVPLSKIIIHTNYSSSDAVGSNDLALLEL 124

  Fly   131 ESPLILSASIQPIDLPTVDTPADVDVVISGWGRIKHQGDLPRYLQYNTLKSITRQQCEELIDFGF 195
            |:.::|:|:..||||.|....|...::.||||..:..|.|...||..|.:|::...|:..:....
  Fly   125 ETSVVLNANTNPIDLATERPAAGSQIIFSGWGSSQVDGSLSHVLQVATRQSLSASDCQTELYLQQ 189

  Fly   196 EGELCLLHQVDN---GACNGDSGGPAVYNNQLVGVAGFVVDGCGSTYPDGYARVFYFKDWIKKHS 257
            |..|| |..||.   |.|:||:|.||.|||||||:|.|.|.||||..||||..|....:||.:::
  Fly   190 EDLLC-LSPVDEDFAGLCSGDAGAPASYNNQLVGIAAFFVSGCGSEQPDGYVDVTQHLEWINENA 253

  Fly   258  257
              Fly   254  253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 91/228 (40%)
Tryp_SPc 32..256 CDD:238113 93/230 (40%)
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 94/237 (40%)
Tryp_SPc 30..249 CDD:214473 92/234 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473225
Domainoid 1 1.000 117 1.000 Domainoid score I5856
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 1 1.000 - - H114140
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7244
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D121264at33392
OrthoFinder 1 1.000 - - FOG0004525
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.