DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and CG9673

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:260 Identity:95/260 - (36%)
Similarity:146/260 - (56%) Gaps:28/260 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLF-LVLPVQSAPGKLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHCVSNE 77
            |:| |:|..:::|   .||::||||..:.::|...|:|...:|.|.|:|::..:|||||||||:.
  Fly    13 LIFGLILSAEASP---QGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSSV 74

  Fly    78 DVNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNFLNDVALLRLESPLILSASIQP 142
            .    |||:.|....:|.|:.::::||.:|.|..||:|..|||||:|:|:|.|:..|:.|..||.
  Fly    75 G----ITPVDASTLAVRLGTINQYAGGSIVNVKSVIIHPSYGNFLHDIAILELDETLVFSDRIQD 135

  Fly   143 IDLP--TVDTPADVD--------VVISGWGRIKHQGDLPRYLQ----YNTLKSITRQQCEELIDF 193
            |.||  |.:...|||        |.::|||.:  ......|.|    ||||   :|..||....:
  Fly   136 IALPPTTDEETEDVDAELPNGTPVYVAGWGEL--SDGTASYKQQKANYNTL---SRSLCEWEAGY 195

  Fly   194 GFEGELCLLHQVDNGACNGDSGGPAVYNNQLV-GVAGFVVDGCGSTYPDGYARVFYFKDWIKKHS 257
            |:|..:||......|.|.||:|...:.::::: |:..|....|||.|||...||.|:..||:.::
  Fly   196 GYESVVCLSRAEGEGICRGDAGAAVIDDDKVLRGLTSFNFGPCGSKYPDVATRVSYYLTWIEANT 260

  Fly   258  257
              Fly   261  260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 87/236 (37%)
Tryp_SPc 32..256 CDD:238113 88/238 (37%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 87/236 (37%)
Tryp_SPc 29..259 CDD:238113 88/238 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7244
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0004525
OrthoInspector 1 1.000 - - otm47449
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.