DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and sphe

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:231 Identity:88/231 - (38%)
Similarity:126/231 - (54%) Gaps:13/231 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHCVSNEDVNHVITPIAAERFTIR 94
            ||::|||||.........|||...:|.||||||::|.|||.||||..:.     ..|.|.|...|
  Fly    24 GRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHRDG-----KLIDASRLACR 83

  Fly    95 AGSNDRFSGGVLVQVAEVIVHEEYGNFLNDVALLRLESPLILSASIQPIDLPTVDT----PAD-V 154
            .||.::::||.:|.|..|.||.:|.|..|::|::.|.|.|..:..|..|  |.|.:    ||: .
  Fly    84 VGSTNQYAGGKIVNVESVAVHPDYYNLNNNLAVITLSSELTYTDRITAI--PLVASGEALPAEGS 146

  Fly   155 DVVISGWGRIKHQGDLPRYLQYNTLKSITRQQCEELIDFGFEGELCLLHQVDNGACNGDSGGPAV 219
            :|:::||||.. .|.....::..:||......|.:......|...||.|::..|.|:||.||.|:
  Fly   147 EVIVAGWGRTS-DGTNSYKIRQISLKVAPEATCLDAYSDHDEQSFCLAHELKEGTCHGDGGGGAI 210

  Fly   220 YNNQLVGVAGFVVDGCGSTYPDGYARVFYFKDWIKK 255
            |.|.|:|:..|||..|||.|||.:.|:..:.|||::
  Fly   211 YGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWIQE 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 85/226 (38%)
Tryp_SPc 32..256 CDD:238113 86/229 (38%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 81/213 (38%)
Tryp_SPc 42..244 CDD:214473 79/209 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I5856
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0004525
OrthoInspector 1 1.000 - - otm47449
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.030

Return to query results.
Submit another query.