DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and prss59.1

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_955899.2 Gene:prss59.1 / 322453 ZFINID:ZDB-GENE-030131-1173 Length:242 Species:Danio rerio


Alignment Length:277 Identity:72/277 - (25%)
Similarity:119/277 - (42%) Gaps:82/277 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLFLVLPVQSAPGKLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHCVSNED 78
            |:|||| :.:|....:.::|||.:...|..|.|.|| |:|.|.||||:::..::::||||..:  
Zfish     4 LVFLVL-LGAAFALDDDKIVGGYECQPNSQPWQASL-NSGYHFCGGSLVSEYWVVSAAHCYKS-- 64

  Fly    79 VNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNFL-----------------NDVA 126
                       |..:|.|.::            ::::|....|:                 :|:.
Zfish    65 -----------RVEVRLGEHN------------IVINEGTEQFITSEKVIRNPNYDSWDLDSDIM 106

  Fly   127 LLRLESPLILSASIQPIDLPTVDTPADVDVVISGWGRIKHQGDLPRYLQYNTLKSI---TRQQCE 188
            |::|..|..|:..:||:.||...........:||||              ||:.|.   .:.||.
Zfish   107 LIKLSKPATLNKYVQPVALPNGCAADGTMCRVSGWG--------------NTMSSTADSNKLQCL 157

  Fly   189 EL-------IDFGFEGEL-----CLLHQVDNG--ACNGDSGGPAVYNNQLVGVA--GFVVDGCG- 236
            |:       .:..:.|.:     |..: ::.|  :|.||||||.|.|.:|.|:.  |:   ||. 
Zfish   158 EIPILSDRDCNNSYPGMITDTMFCAGY-LEGGKDSCQGDSGGPVVCNGELHGIVSWGY---GCAE 218

  Fly   237 STYPDGYARVFYFKDWI 253
            ..:|..|.:|..|..||
Zfish   219 KNHPGVYGKVCMFSQWI 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 64/258 (25%)
Tryp_SPc 32..256 CDD:238113 66/259 (25%)
prss59.1NP_955899.2 Tryp_SPc 20..235 CDD:214473 64/258 (25%)
Tryp_SPc 21..238 CDD:238113 66/259 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.