DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and CG31827

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_723923.1 Gene:CG31827 / 318965 FlyBaseID:FBgn0051827 Length:294 Species:Drosophila melanogaster


Alignment Length:265 Identity:74/265 - (27%)
Similarity:115/265 - (43%) Gaps:63/265 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GGEDAVKNQ------------FPHQVSLRNAGSHSCGGSILTRTYILTAAHCVSNEDVNHVITPI 86
            |..||||.|            ||..:::.:..|...|||::|...:|||||.:.|:||..::   
  Fly    34 GNPDAVKVQFNVTEGQAKPAEFPWTIAVIHNRSLVGGGSLITPDIVLTAAHRIFNKDVEDIV--- 95

  Fly    87 AAERFTIRAGSNDRFSGGVLVQ-------VAEVIVHE--EYGNFLNDVALLRLESPLILSASIQP 142
                  :.||..:  .|..|.:       |.::::|:  .|....|::|||.|:....|:..|..
  Fly    96 ------VSAGEWE--YGSALEKYPFEEAFVLKMVIHKSFNYQRGANNLALLFLDREFPLTYKINT 152

  Fly   143 IDLPTVD-TPADVDVVISGWGRIK----HQG------DL---PRYLQYNTLKSITRQQCEELIDF 193
            |.|||.. :.:....:::|||:.:    |.|      ||   ||::..:.|:.....|...|.  
  Fly   153 ICLPTQKRSLSSTRCIVAGWGKYQFSDTHYGGVLKKIDLPIVPRHICQDQLRKTRLGQNYTLP-- 215

  Fly   194 GFEGELCLLHQVDNGACNGDSGG---------PAVYNNQLVGVAGFVVDGC-GSTYPDGYARVFY 248
              .|.:|...:.||.||.||.||         |..:  :.:|:..:.| || ....|..|..||.
  Fly   216 --RGLICAGGEKDNDACTGDGGGALFCPMTEDPKQF--EQIGIVNWGV-GCKEKNVPATYTDVFE 275

  Fly   249 FKDWI 253
            ||.||
  Fly   276 FKPWI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 72/263 (27%)
Tryp_SPc 32..256 CDD:238113 74/265 (28%)
CG31827NP_723923.1 Tryp_SPc 50..283 CDD:238113 68/249 (27%)
Tryp_SPc 50..280 CDD:214473 66/247 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457582
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.