DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and CG31780

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster


Alignment Length:249 Identity:72/249 - (28%)
Similarity:110/249 - (44%) Gaps:50/249 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 AVKNQFPHQVSLRNA--GSHSCGGSILTRTYILTAAHCVSNEDVNHVITPIAAERFTIRAGSNDR 100
            |.:.:.|..|:|.:|  .|:..||:::....::||.....|         :.|.:..:|||..| 
  Fly   113 AQEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQRTEN---------MTASQLVVRAGEWD- 167

  Fly   101 FS------GGVLVQVAEVIVHEEYG--NFLNDVALLRLESPLILSASIQPIDLPTVDTPADVD-- 155
            ||      ..|.|.:..::.|..:.  |..|:|||:.|...|..|..|.||.:|:  .|.:.|  
  Fly   168 FSTKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPS--APKNFDFS 230

  Fly   156 -VVISGWGRIKHQGDLPRYLQYNTLKSIT-----RQQCEELI------DFGFEGEL-CLLHQVDN 207
             .:.:|||  |:..|.|.|:  |.||.|:     |:.||:.:      ||..:..| |...:...
  Fly   231 RCIFTGWG--KNSFDDPSYM--NVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGK 291

  Fly   208 GACNGDSGGP---AVYNN----QLVGVAGFVVDGCG-STYPDGYARVFYFKDWI 253
            .:|.||.|.|   |:.:|    :|.|:..|.|| || ...|..|..|....:||
  Fly   292 DSCEGDGGSPLACAIKDNPQRYELAGIVNFGVD-CGLPGVPAVYTNVANVIEWI 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 70/247 (28%)
Tryp_SPc 32..256 CDD:238113 72/249 (29%)
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 70/247 (28%)
Tryp_SPc 113..344 CDD:238113 70/247 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457594
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.