DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and CG31267

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster


Alignment Length:275 Identity:78/275 - (28%)
Similarity:129/275 - (46%) Gaps:40/275 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GKVAILLCSFLLFLVLPVQSA--------------PGKLNGRVVGGEDAVKNQFPHQVSLRNA-G 53
            |.|:.|:   |:.|.|....|              ..|.:.|:||||::.....|:.|||:|| |
  Fly     6 GAVSTLV---LVLLALSFSEASLRRRAFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQNAYG 67

  Fly    54 SHSCGGSILTRTYILTAAHCVSNEDVNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEY 118
            :|.|.|||:...:::|||.|::....|:|        ..:....|...|.|.:..|.::::|..:
  Fly    68 NHFCAGSIIHDQWVITAASCLAGLRKNNV--------QVVTTTYNHWGSEGWIYSVEDIVMHCNF 124

  Fly   119 GN--FLNDVALLRLESPLILSASIQPIDL-PTVDTPADVDVVISGWGRIKHQGDLPRYLQYNTLK 180
            .:  :.||:||::..:........|.|.: |..|......:.:.|:|..:..||....||...:.
  Fly   125 DSPMYHNDIALIKTHALFDYDDVTQNITIAPLEDLTDGETLTMYGYGSTEIGGDFSWQLQQLDVT 189

  Fly   181 SITRQQCEEL------IDFGFEGELCLLHQVDNGACNGDSGGPAV-YNNQLVGVAGFVVDGCGST 238
            .:..::|...      :|.   |.||.:.:|..|||:||:|||.| ...:||||..:.|. ||..
  Fly   190 YVAPEKCNATYGGTPDLDV---GHLCAVGKVGAGACHGDTGGPIVDSRGRLVGVGNWGVP-CGYG 250

  Fly   239 YPDGYARVFYFKDWI 253
            :||.:||:.::..||
  Fly   251 FPDVFARISFYYSWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 68/232 (29%)
Tryp_SPc 32..256 CDD:238113 69/233 (30%)
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 68/232 (29%)
Tryp_SPc 45..268 CDD:238113 69/233 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.