DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and CG32376

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:233 Identity:65/233 - (27%)
Similarity:112/233 - (48%) Gaps:19/233 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHCVSNEDVNHVITPIAAERFTIRA 95
            |:|.|:.....:.|.|.||...|...||..|:.:.:||||.||...          ..|::|:|.
  Fly    65 RIVNGKRIPCTEAPFQGSLHYEGYFVCGCVIINKIWILTAHHCFFG----------PPEKYTVRV 119

  Fly    96 GSNDRFSGGVLVQVAEVIVHEEYGNFL--NDVALLRLESPLILSASIQPIDLP-TVDTPADVDVV 157
            ||:.:..||.|..|.:::....|.::.  :|:|:::|:||:.....::|:.|| |..|......|
  Fly   120 GSDQQRRGGQLRHVKKIVALAAYNDYTMRHDLAMMKLKSPVYFGKCVRPVKLPSTKTTKFPKKFV 184

  Fly   158 ISGWG-RIKHQGDLPRYLQYNTLKSITRQQCEELIDFG----FEGELCLLHQVDNGACNGDSGGP 217
            :|||| ...:..::.|||:...:..|.|.:|:::....    ::..:| ..:.:..:|:||||||
  Fly   185 VSGWGITSANAQNVQRYLRRVQIDYIKRSKCQKMYKKAGLKIYKDMIC-ASRTNKDSCSGDSGGP 248

  Fly   218 AVYNNQLVGVAGFVVDGCGSTYPDGYARVFYFKDWIKK 255
            ......|.|:..:.:......||..|.....:..||||
  Fly   249 LTSRGVLYGIVSWGIGCANKNYPGVYVNCKRYVPWIKK 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 61/229 (27%)
Tryp_SPc 32..256 CDD:238113 64/232 (28%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 61/229 (27%)
Tryp_SPc 66..287 CDD:238113 64/232 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457799
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.