DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and CG6041

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster


Alignment Length:301 Identity:86/301 - (28%)
Similarity:126/301 - (41%) Gaps:78/301 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AILLCSFLLFLVLPVQS----APGKLNGRVVGGEDAVKNQFPHQVSLR-------NAGS-HSCGG 59
            |||..:..|..:...:|    ..||:..::|||.||...|..:|||:|       :.|| |.|||
  Fly     6 AILAIALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGG 70

  Fly    60 SILTRTYILTAAHCVSNEDVNHVITPIAAERFTIRAG------SNDRFSGGVLVQVAEVIVHEEY 118
            .::::..:.|||||....|.....|   |..|.:..|      |.||   .::..:.::|.||.|
  Fly    71 VVISQRLVATAAHCCYITDKKKYRT---AGEFVLVMGSTYLTSSTDR---TLMYYLQQLITHENY 129

  Fly   119 G--NFLNDVALLRLESPLILSASIQPIDLPTVDTPA--------DVDVVISGWGRIKHQGDLPRY 173
            .  ...||:||:.:...:       |.:.|||...|        :.|.:|||||.::..|.    
  Fly   130 NPDALTNDIALMFINGYI-------PWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGT---- 183

  Fly   174 LQYNTLKSIT------------------RQQCEELIDFGFEGELCLLHQVDNGACNGDSGGPAVY 220
            ...|||::.|                  .|.|...:..|.:            ||.||||||...
  Fly   184 FSSNTLQAATVPIVSYTTCRISYNSIPVSQVCAGYLSGGVD------------ACQGDSGGPMSC 236

  Fly   221 NNQLVGVAGFVVDGCGST-YPDGYARVFYFKDWI-KKHSDV 259
            |..|.|:..:.. ||.:. ||..|..|.|:.||| :|:|.:
  Fly   237 NGMLAGIVSYGA-GCAAPGYPGVYTNVSYYYDWIVQKNSSL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 75/264 (28%)
Tryp_SPc 32..256 CDD:238113 77/267 (29%)
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 75/264 (28%)
Tryp_SPc 35..272 CDD:238113 77/266 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.