DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and CG14780

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster


Alignment Length:273 Identity:83/273 - (30%)
Similarity:128/273 - (46%) Gaps:33/273 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CSFLLF-LVLPVQSAPGKLN--GRVVGGEDAVKNQFPHQVSLR------NAGS-HSCGGSILTRT 65
            ||::|| .:|...:|..:.|  .|::.|..|..::..|.||:|      |.|| |.|||:::...
  Fly     9 CSYILFWFLLACAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPR 73

  Fly    66 YILTAAHCVSNEDVNHVITPIAAERFTIRAGSNDRF---SGGVLVQVAEVIVHEEYG--NFLNDV 125
            .:||||||:.|......   ..|..|.:..|:.:||   :|.::.||:.:.....:.  :..:||
  Fly    74 KVLTAAHCLYNNQRKRF---RRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRDDV 135

  Fly   126 ALLRLESPLILS------ASIQPIDLPTVDTPADVDVVISGWGRIKHQGDLPRYLQYNTLKSITR 184
            .:|.|.:.|.:|      .::.||.|....||......::||||.: |..|...|....:.:|..
  Fly   136 GILFLRTGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGRTE-QSSLSNILLTANVSTIRH 199

  Fly   185 QQCEELIDFG-FEGELCLLH-QVDNGACNGDSGGPAVYNNQLVGVA--GFVVDGCGST-YPDGYA 244
            |.|..:...| ..|.:|... |....:|.||||||.|:..:||||.  |:   ||... .|..|.
  Fly   200 QTCRMIYRSGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGY---GCAEPGLPGVYV 261

  Fly   245 RVFYFKDWIKKHS 257
            .|.|::.||:..|
  Fly   262 DVEYYRQWIEGRS 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 73/244 (30%)
Tryp_SPc 32..256 CDD:238113 74/246 (30%)
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 73/244 (30%)
Tryp_SPc 33..271 CDD:238113 73/244 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.