DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and Klk12

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_008757573.1 Gene:Klk12 / 308564 RGDID:1308975 Length:247 Species:Rattus norvegicus


Alignment Length:264 Identity:75/264 - (28%)
Similarity:114/264 - (43%) Gaps:42/264 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VAILLCSFLLFLVLPVQSAPGKLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTA 70
            :.:|||      |:.:..|..:   ::..|.:.|||..|.||.|.:.....|||.::.|.::|||
  Rat     5 ILLLLC------VVGLSQADRE---KIYNGVECVKNSQPWQVGLFHGKYLRCGGVLVDRKWVLTA 60

  Fly    71 AHCVSNEDVNHVITPIAAERFTIRAGSNDRFSGGVLVQ-------VAEVIVHEEYGNFLNDVALL 128
            |||              :.::.:|.|.:......:..|       :.....|..|.|..:|:.||
  Rat    61 AHC--------------SGKYMVRLGEHSLSKLDLTEQLRLTTFSITHPSYHGAYQNHEHDLRLL 111

  Fly   129 RLESPLILSASIQPIDLPTVDTPADVDVVISGWGRIKHQGD-LPRYLQYNTLKSITRQQCEELID 192
            ||..|:.|:.:::|:.||:...|......|||||......| .|..||...|..::.:.|..:  
  Rat   112 RLNRPISLTYAVRPVALPSSCAPTGAKCHISGWGTTNKPWDPFPDRLQCLDLSIVSNETCRAV-- 174

  Fly   193 FGFEGE-----LCLLHQVDNGACNGDSGGPAVYNNQLVGVAGF-VVDGCGST-YPDGYARVFYFK 250
              |.|.     ||...:....||.||||||.|....|.|:..: .|..||.. .|..|.:|..:.
  Rat   175 --FPGRVTENMLCAGGEAGKDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQKGIPGVYTKVCKYT 237

  Fly   251 DWIK 254
            |||:
  Rat   238 DWIR 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 68/236 (29%)
Tryp_SPc 32..256 CDD:238113 70/238 (29%)
Klk12XP_008757573.1 Tryp_SPc 21..240 CDD:214473 68/236 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.