DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and Tpsg1

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_783183.1 Gene:Tpsg1 / 302990 RGDID:631355 Length:311 Species:Rattus norvegicus


Alignment Length:270 Identity:87/270 - (32%)
Similarity:125/270 - (46%) Gaps:40/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CSFLLFLVLPVQSAP--GKLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHC 73
            |.|||.|.:|....|  .....|:|||..|....:|.|.|||....|.||||:|:..::||||||
  Rat     7 CGFLLLLAVPGCGQPQVSHAGSRIVGGHAAQAGAWPWQASLRLQKVHVCGGSLLSPEWVLTAAHC 71

  Fly    74 VSNEDVNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEY----GNFLNDVALLRLESPL 134
            .|. .||.....:.....||..  :..||     .|.::|::...    |: ..|:||::|.:|:
  Rat    72 FSG-SVNSSDYEVHLGELTITL--SPHFS-----TVKQIIMYSSAPGPPGS-SGDIALVQLATPV 127

  Fly   135 ILSASIQPIDLP--TVDTPADVDVVISGWGRIKHQGDL--PRYLQYNTLKSITRQQCEE------ 189
            .||:.:||:.||  :.|....:...::|||..:....|  |..||...:..:..:.|.:      
  Rat   128 ALSSQVQPVCLPEASADFHPGMQCWVTGWGYTQEGEPLKPPYNLQEAKVSVVDVETCSQAYSSSN 192

  Fly   190 --LIDFGFEGELCLLHQVDNGACNGDSGGPAVYNNQLVGV---AGFVV--DGCG-STYPDGYARV 246
              ||.   ...||.....|  ||..|||||.|.  ::.|:   ||.|.  :||| ...|..||||
  Rat   193 GSLIQ---SDMLCAWGPGD--ACQDDSGGPLVC--RVAGIWQQAGVVSWGEGCGRPDRPGVYARV 250

  Fly   247 FYFKDWIKKH 256
            ..:.:||.:|
  Rat   251 TAYVNWIHRH 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 77/243 (32%)
Tryp_SPc 32..256 CDD:238113 78/245 (32%)
Tpsg1NP_783183.1 Tryp_SPc 29..257 CDD:214473 77/243 (32%)
Tryp_SPc 30..260 CDD:238113 78/245 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346427
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.