DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and Elane

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001100237.1 Gene:Elane / 299606 RGDID:1307968 Length:271 Species:Rattus norvegicus


Alignment Length:267 Identity:83/267 - (31%)
Similarity:123/267 - (46%) Gaps:44/267 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LCSFLLFLVLPVQSAPGKLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHCV 74
            |.|.||.|:|...:    |...:|||..|..:.:|..|||:..|.|.||.:::.|.::::|||||
  Rat    15 LASMLLALLLVCPA----LASEIVGGRPAQPHAWPFMVSLQRRGGHFCGATLIARNFVMSAAHCV 75

  Fly    75 SNEDVNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGN------FLNDVALLRLESP 133
            :..:...|...:.|.....|..:...||           |...:.|      .|||:.:::|...
  Rat    76 NGRNFQSVQVVLGAHDLRRREPTRQIFS-----------VQRIFENGFDPSRLLNDIVIIQLNGS 129

  Fly   134 LILSASIQPIDLPTVD------TPADVDVVISGWGRIKHQGDLPRYLQYNTLKSITRQQCEELID 192
            ..::|::|..:||...      ||.    |..||||:.....||..||...:..:| ..|...::
  Rat   130 ATINANVQVAELPAQGQGVGNRTPC----VAMGWGRLGTNRPLPSVLQELNVTVVT-NLCRRRVN 189

  Fly   193 FGFEGELC-LLHQVDNGACNGDSGGPAVYNNQLVGVAGFVVDGCGS-TYPDGYARVFYFKDW--- 252
                  :| |:.:...|.|.||||||.|.||.:.|:..|:..|||| .|||.:|.|..|.||   
  Rat   190 ------VCTLVPRRQAGICFGDSGGPLVCNNLVQGIDSFIRGGCGSGFYPDAFAPVAEFADWINS 248

  Fly   253 -IKKHSD 258
             |:.|.|
  Rat   249 IIRSHDD 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 73/239 (31%)
Tryp_SPc 32..256 CDD:238113 74/241 (31%)
ElaneNP_001100237.1 Tryp_SPc 32..246 CDD:214473 72/235 (31%)
Tryp_SPc 33..249 CDD:238113 73/237 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.