DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and Klk9

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001099723.1 Gene:Klk9 / 292851 RGDID:1308280 Length:258 Species:Rattus norvegicus


Alignment Length:245 Identity:66/245 - (26%)
Similarity:103/245 - (42%) Gaps:42/245 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHCVSNEDVNHVITPIAAERFTIRA 95
            |.||..:..:|..|.|..|.......||.:::...::||||||             ......:|.
  Rat    22 RAVGARECQRNSQPWQAGLFYLTRQLCGATLINDQWLLTAAHC-------------RKPYLWVRL 73

  Fly    96 GSND--RFSG-GVLVQVAEVIVHEEYGNFL------NDVALLRLESPLILSASIQPID----LPT 147
            |.:.  ::.| ..|:.|.:...|..:...|      :|:.|:||...:.||.::||::    ||:
  Rat    74 GEHHLWQWEGPEKLLLVTDFFPHPGFNPDLSANDHNDDIMLIRLPRKVRLSPAVQPLNLSQSLPS 138

  Fly   148 VDTPADVDVVISGWGRIKHQG-DLPRYLQYNTLKSITRQQCEELIDFGFEGE-----LCL-LHQV 205
            |.|    ..:|||||.:.... ..|..||...:..:..:.|.    :.:.|.     ||. |.:.
  Rat   139 VGT----QCLISGWGSVSSSKIQFPMTLQCANISILDNKLCR----WAYPGHISEKMLCAGLWEG 195

  Fly   206 DNGACNGDSGGPAVYNNQLVGVAGFVVDGCGSTY-PDGYARVFYFKDWIK 254
            ..|:|.||||||.|....|.|:.....:.|.... |..|..||::.|||:
  Rat   196 GRGSCQGDSGGPLVCKGTLAGIVSGGSEPCSRPQRPAVYTSVFHYLDWIE 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 64/242 (26%)
Tryp_SPc 32..256 CDD:238113 65/244 (27%)
Klk9NP_001099723.1 Tryp_SPc 24..247 CDD:238113 65/243 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.