DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and Klk10

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001004100.1 Gene:Klk10 / 292850 RGDID:1303242 Length:279 Species:Rattus norvegicus


Alignment Length:236 Identity:65/236 - (27%)
Similarity:110/236 - (46%) Gaps:44/236 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PHQVSLRNAGSHSCGGSILTRTYILTAAHCVSNEDVNHVITPIAAERFTIRAGSND--RFSGGVL 106
            |.||||.:.....|.|.::.:.::||||||..|:       |:.|     |.|.:.  .|....|
  Rat    59 PWQVSLFHNLQFQCAGVLVDQNWVLTAAHCWRNK-------PLRA-----RVGDDHLLLFQSEQL 111

  Fly   107 VQVAEVIVHEEY----GNFL------NDVALLRLESPLILSASIQPIDLPTVDTPADVDVVISGW 161
            ......:.|.:|    |..|      :|:.:|:|.||::|::.:.|:.||........:..:|||
  Rat   112 RSTNSPVFHPKYQPCSGPVLPLRSDEHDLMMLKLSSPVVLTSKVHPVQLPFQCAQPRQECQVSGW 176

  Fly   162 G-----RIKHQGDLPRYLQYNTLKSITRQQCEELIDFGFEG-----ELCLLHQVDNGACNGDSGG 216
            |     |:|:.    |.|..:.:..::::|||..    :.|     .:|.....|..:|..||||
  Rat   177 GTTANRRVKYN----RSLSCSRVTLLSQKQCETF----YPGVITNNMICAGMDRDQDSCQSDSGG 233

  Fly   217 PAVYNNQLVGVAGFVVDGCGST--YPDGYARVFYFKDWIKK 255
            |.|.:|.|.|:..:.:..||:.  ||..||::..:.:||::
  Rat   234 PLVCDNTLHGILSWSIYPCGAATQYPAVYAKICNYTNWIRR 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 63/232 (27%)
Tryp_SPc 32..256 CDD:238113 65/236 (28%)
Klk10NP_001004100.1 Tryp_SPc 50..272 CDD:214473 63/232 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.