DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser6 and Klk11

DIOPT Version :9

Sequence 1:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001099722.1 Gene:Klk11 / 292849 RGDID:1308690 Length:279 Species:Rattus norvegicus


Alignment Length:261 Identity:68/261 - (26%)
Similarity:112/261 - (42%) Gaps:30/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLCSFLLFLVLPVQSAPGKLNG--RVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAA 71
            ||.:.::...:.:....|.:.|  |::.|.:...:..|.||:|.......||.:::...::||||
  Rat    26 LLQAMMILRFIALALVTGHVGGETRIIKGYECRPHSQPWQVALFQKTRLLCGATLIAPKWLLTAA 90

  Fly    72 HCVSNEDVNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNFL------NDVALLRL 130
            ||..    .|.:..:.........|...|      ....|...|..:.|.|      ||:.|:::
  Rat    91 HCRK----PHYVILLGEHNLEKTDGCEQR------RMATESFPHPGFNNSLPNKDHRNDIMLVKM 145

  Fly   131 ESPLILSASIQPIDLPTVDTPADVDVVISGWGRIKH-QGDLPRYLQYNTLKSITRQQCEELIDFG 194
            .||..::.:::|:.|.::...|....:|||||.... |..||..|:...:..|..::||.    .
  Rat   146 SSPAFITRAVRPLTLSSLCVTAGTSCLISGWGTTSSPQLRLPHSLRCANVSIIGHKECER----A 206

  Fly   195 FEGE-----LCL-LHQVDNGACNGDSGGPAVYNNQLVGVAGFVVDGCGSTYPDG-YARVFYFKDW 252
            :.|.     ||. :.:....:|.||||||.|.|..|.|:..:..|.|..|...| |.:|..:.||
  Rat   207 YPGNITDTMLCASVRKEGKDSCQGDSGGPLVCNGSLQGIISWGQDPCAVTRKPGVYTKVCKYFDW 271

  Fly   253 I 253
            |
  Rat   272 I 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 62/235 (26%)
Tryp_SPc 32..256 CDD:238113 63/236 (27%)
Klk11NP_001099722.1 Tryp_SPc 50..272 CDD:214473 62/235 (26%)
Tryp_SPc 51..275 CDD:238113 63/236 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.